PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004503191.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 236aa    MW: 27232.6 Da    PI: 10.1967
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004503191.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.41.6e-171050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i n+s r+ tf kR++g++KK +ELS+LC+++++ ii+s+
  XP_004503191.1 10 FIINDSARKATFKKRKKGLMKKVSELSTLCGIDACAIIYSP 50
                    789*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.61149IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-23160IPR002100Transcription factor, MADS-box
CDDcd002661.98E-23285No hitNo description
SuperFamilySSF554552.22E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-7323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-181051IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MTRKKVKLAF IINDSARKAT FKKRKKGLMK KVSELSTLCG IDACAIIYSP YDPQPEVWPA  60
PLGVQKVLSK FRRMPELEQS KKMVNQESFL RQRIQKAKEH LTKQRKDNRE KEMTQLMFQY  120
LSADKVMHNI NMVDLNDMAW MIDQYLKDIN RRVEVLTKNA QGQPQMVAPQ VVTNVVAKVE  180
DNNGQGSHGH VLDMNLDVMQ KQNWFMNLMN NGGGDEAPPM GDVNHQNGFW PSPFFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFIINDSARKATFKKRK
22125KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1488181e-174AC148818.15 Medicago truncatula clone mth2-39c7, complete sequence.
GenBankCT0095351e-174CT009535.6 M.truncatula DNA sequence from clone MTH2-68D12 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004503191.11e-178PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK38e-69AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLG7J8R01e-136G7J8R0_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA11G33460.11e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.15e-70AGAMOUS-like 80